SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021757 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021757
Domain Number 1 Region: 316-578
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-68
Family Nuclear receptor ligand-binding domain 0.00000000749
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-27
Family Nuclear receptor 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021757   Gene: ENSLACG00000019120   Transcript: ENSLACT00000021898
Sequence length 580
Comment pep:novel scaffold:LatCha1:JH126563.1:8422854:8439853:1 gene:ENSLACG00000019120 transcript:ENSLACT00000021898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCIQTQCEVLPGSGSPHENYPSEFLIPDFGKFSVNLASTEVPASRALPSFSTFVDSYAA
EFDAYLYQLMPSNPQPFKLEDFQVYGCYTGSFSSQIEETLSSCGSDYYSSPCSAPSPSAS
GFQTQQVPAWDSSFGTFSSPQTYDNMNSWNDQQKNNVSPSPLFSFNPSPLSTGVSGCSLK
IQPTMHGLDQQLLENEAFGLSQQSPMAFASLRMDHRTPILDSPILLDQSTSPIKSQSPSS
NEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCLASKDCPVDKRRRNRCQFC
RFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQVQDGVLPPSPTSLISSLVRAHMDSITS
AAKLDSSKFQEPSPYQSGKEDITDVQQFYELLTGSMEVIQKWAENIPGFKHLPKEDQDLL
LESAFLELFILRLAYRSIPEEEKLIFCNGMVLHRLQCIRGFGEWIDSILEFSRSLHRMNI
EVPAFACLAALVIITDRHGLKEPKKVEDLQNGIIAGLKDHVASTASESHRPSCLSKFLGK
LPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences H3BIN6
ENSLACP00000021757 ENSLACP00000021757 XP_005986360.1.90931 XP_014340441.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]