SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021759 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021759
Domain Number 1 Region: 324-388
Classification Level Classification E-value
Superfamily FF domain 2.09e-18
Family FF domain 0.0000325
Further Details:      
 
Domain Number 2 Region: 460-535
Classification Level Classification E-value
Superfamily FF domain 0.00000000000487
Family FF domain 0.0033
Further Details:      
 
Domain Number 3 Region: 685-746
Classification Level Classification E-value
Superfamily FF domain 0.00000000000576
Family FF domain 0.00013
Further Details:      
 
Domain Number 4 Region: 543-615
Classification Level Classification E-value
Superfamily FF domain 0.00000000000628
Family FF domain 0.0052
Further Details:      
 
Domain Number 5 Region: 165-200
Classification Level Classification E-value
Superfamily WW domain 0.00000000278
Family WW domain 0.0017
Further Details:      
 
Domain Number 6 Region: 393-462
Classification Level Classification E-value
Superfamily FF domain 0.00000013
Family FF domain 0.0058
Further Details:      
 
Domain Number 7 Region: 117-146
Classification Level Classification E-value
Superfamily WW domain 0.0000904
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021759   Gene: ENSLACG00000019122   Transcript: ENSLACT00000021900
Sequence length 894
Comment pep:novel scaffold:LatCha1:JH126563.1:8495773:8526066:1 gene:ENSLACG00000019122 transcript:ENSLACT00000021900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSLQMPPPGMPPPFPPMGMPPMGQRPPAMPPMPPGMMPPMIPPMAGPPPMGQMPGMMPPM
MPGMMMPPMPSGPIPATPPAAAPSTETVLMPTPRPTTIPSPAVTAVHPSVAGGSTPVLEA
PRKKSPWTEHKAPDGRTYFYNSETKEKHQGQATLSKRGCLKGPFELLLSQCPWKEYKSDT
GKPYYYNSQNKESRWTKPKELEELEALIKQEEEEEAAVEAGDATLITQGAALSLCTVNVL
SVSLRRGTHTAASFFLSLSLSLFTLEPEATTLEENEPLNSQPTVQSVPETTEIPGAAPQE
ELVEQREEQVEEAVKKEEEEKKEPEKKTYSWSTKEEAKQAFKELLKEKSVPSNASWEQAM
KMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLKAKEAKEKLQRFLEQHEKMTS
STRYRKAEQMFGEQEVWSIVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNIQALKNILD
SMANVTYQTTWSEAQQYLMDNPTFAEDEDLQNMDKEDALICFEEHIRALEKEEEEEKEKS
RLRERRQQRKNRESFQAFLDELHETGQLHSMSTWMELYPSISVDIRFSNMLGQPGSTPLD
LFKFYVEDLKARFHDEKKIIKDILKDRNCTVEINTTFEDFAHVISFDKRAATLDAGNIKL
TFNSLLEKAEAREREREKEEARKLRRKEAAFKSMLKQEAPPLEPDSNWDEVRDRFVNDSA
FDQITVESERIRLFKEFLQVLENECQHYHSKSKKHSKKSKKHHRKRSRSQSGSESDEDDH
HHRSQKKRKRNHSESASDHSSSGDSEDTPESDGEREKEKSRKEREKENEKEKDREREKDC
EKAKERERSETRYKSPKRTAKKEKTGWDTSESELSEGELEKRRRTLLQQLDDDQ
Download sequence
Identical sequences H3BIN8
ENSLACP00000021759 ENSLACP00000021759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]