SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023474 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023474
Domain Number 1 Region: 881-1072
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00074
Further Details:      
 
Domain Number 2 Region: 38-74
Classification Level Classification E-value
Superfamily WW domain 0.000000312
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023474   Gene: ENSLACG00000012244   Transcript: ENSLACT00000026447
Sequence length 1077
Comment pep:novel scaffold:LatCha1:JH127075.1:400676:1056481:-1 gene:ENSLACG00000012244 transcript:ENSLACT00000026447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERLEWVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTNENQWWELFDPNTSRFYYY
NASTQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASAENSPGRSSNVSREGSTSSSLDQE
LEGSEKGQEQTRPNRQPPQQPTGKEEAERTSPHRWNTGTKERMLIKVTDREPSFLLHQGN
GFAPDNQYGTRPRRLSGNQLPPHLQSFSPDTDNSVFYTERKQSPFLKRVEHIGSCSPLLM
RGDPFHSPIQSQHRKYSNESQPSSPRYAYEPPLYEEPPVEYQAPIYDEPPMDVQCDASSN
YRVASPQKSPVRKPYPYLHSPKQGHNSPYQQLVLTKQKCPEKFMSLEYSPAGKEYVRQLV
YVEQSGSSPKVKSGSKHRYTPNPMGGSYSLQHSQSLIREQRFEIRSGDYSSMEGHDIRHS
HPCSQLSNEDSMSWSSQQDTMSSTGYSPNTRKRKSRKPSLTQDTILASADSSGELNLVSE
RLIAEERNSPIVSRPQVSRSESKCTEAEMSRGFPENFMAHARLAWEAQQAHHHMKQRSSW
DSQKDASGYESDGALPLPMPGPVVRAFSEDEALAQQESKHWKRSTFEKLGFPQILLEKSV
SVQTNLASPEPYLHPSQSEDLGTCGQYDGRQNRNMMPSASCVFPTFTLRKPSSETDIENW
ASKHFNKHTQGLFRRKVSIANMLSWSSESIKKPMIMTSDRNVKKEACEIFKLIQMYMGDR
RAKTDQLNVALEIATKGWSMQGLRDELYIQLCRQTTENFRYESLARGWELMAICLAFFPP
TPKFHSYLEGYIYRHMDPVNDTKVTQHIKELLERHNKKISKLRKKRKPHFEEPDGVAISA
YAKYCHSKLQKAALLGAKKGLKKPNLEEIKHAKNAIFSPSMFGSSLEEIMSMQKECYPDR
QLPWVQTRLSEEVLALNGDQIEGIFRVPGDIDEVNALKLQVDQWKIPTGLEDPHVPASLL
KLWYRELEEPLIPHDFYDQCITHYENPEAAIAVVHSLPKVNKMVLCYLIRFLQVFAQPAN
VAVTKMDVNNLAMVMAPNCLRCQSDDPRIIFENTRKEMSFIRVLIQHLDTSFMEGVL
Download sequence
Identical sequences M3XL68
ENSLACP00000023474 XP_014345888.1.90931 ENSLACP00000023474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]