SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_11232T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOAG_11232T0
Domain Number - Region: 12-60
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0849
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_11232T0
Sequence length 81
Comment | LOAG_11232 | Loa loa V3 hypothetical protein (82 aa)
Sequence
MCRKKTILAIKLTELVNDIKLYLKKLYELNEQFPEEFIKGKDKIDEIEQDAQKIIEAISQ
IRNAWNVEDYEKNMAIICGIS
Download sequence
Identical sequences A0A1S0TNW3
LOAG_11232T0 XP_020301529.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]