SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_15819T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOAG_15819T0
Domain Number - Region: 79-142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0647
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_15819T0
Sequence length 202
Comment | LOAG_15819 | Loa loa V3 hypothetical protein (203 aa)
Sequence
MQRRSCENRNNLLLLIEWLSISNPTLTARLLLQRSDIIAKRVNDKLLIAPCNVNKSEWKK
VEFQAGIVSKFEIERINAELEILAQRHEIINLNTDLPNPESFWTELDQQGEELIEQFTVQ
IGKTTEIIEKELAHITAHWELITIGAFSSVILIMIIVVELKFKLISYIYHFLCNKNSKHM
ESIPVEILQIPFNGHRDPNSCN
Download sequence
Identical sequences A0A1S0TEZ6
XP_003151355.1.37734 LOAG_15819T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]