SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_18140T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_18140T0
Domain Number 1 Region: 586-698
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-26
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 2 Region: 734-812
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000433
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  LOAG_18140T0
Domain Number - Region: 133-204
Classification Level Classification E-value
Superfamily Tropomyosin 0.0314
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_18140T0
Sequence length 876
Comment | LOAG_18140 | Loa loa V3 apoptotic enhancer 1 protein (877 aa)
Sequence
MYGYNRTAANSCSNGNGINDGVELIHATDSLSRIQSNNGFLPSKMSHQPIRVVQPPTQHT
TSHSRAQRNYHGSSSIKYDDLVQTAEQQRRLIDANRRMIHDHEIRRNRGIDNAPIRLAVL
RNEILFEEREMARLKMLEDETQQASNRRIIAERQLNNLQINYTSQEQHLRSVISKISSLQ
TQLDILRHRRLIALNAAREQQQRLMSSQIKLTNTDTMQTLLSVMPSLTTISNSDIILQND
ISGSKSSILPSTQHSVVSHSNQQNDIRMLRQISSISDSEKPTNPSFDLPYRPRASVEPFQ
VNQSKSLVDTRSELSSSCPPQLLNVPFNTSKFKKDGANFTVDRNSSPSPPKDPYPTVENT
SDNKTIKLDERIFDTADHLNKKLSSSISEIVEKHQIQQQKSMMIKSNSTMIQQNKQLALD
LVDNMKLTRADQISIRPDTLRAAKRRSWALQDSASCNETEYIRKILLDEQKKGRTHLLVG
CNIGNLFTVVNKNTINKSEIIHEEEKDAIEDTVATPNEYICELLMRDIQLDELPIEIEHL
EEYEQEKVFVSNEFTGEMADEMDEQKKTSGIAELIKPLPEKGILRHNKMKNISRKVVFDP
LALLLDAALEGEMDLVKASAAKLPNISACNDEGITALHNAICAGHYEIVRYLVDSFADVN
AQDSDGWTPLHCAASCNNLPMVKLLVENGACIFAQTLSDLETPAEKCEEDEDGYEGCQLY
LKAADQEAGIVNDGLMYAAYDYEKEQDDELSFSIGACLRVLEKGVNDQTWWLCEIVTEDH
CNIRVGTAEQGLVPRNYLSLYPSLSKRSANFKMFDLPQLPKIHESKKDNMDVKEWRRSSS
SSSSSSSSSGSSMMGKITEENHDGTIIEQSVSISVS
Download sequence
Identical sequences A0A1S0UG43
XP_020305471.1.37734 LOAG_18140T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]