SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_00324T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_00324T0
Domain Number 1 Region: 810-921
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000026
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOAG_00324T0
Sequence length 932
Comment | LOAG_00324 | Loa loa V3 hypothetical protein (933 aa)
Sequence
MQRTKERELLIDKENALLDCKLEKSLTQSVTESIISRPLLNRNREQSIHSIYPTEELELM
KRISLDNSRNQSSDLPHDDSIADKSCNDKLRARFAALAADVENFEYDMKPIRSKESFLKG
PSPRLSSGDMSPTVLFTPATNYYPPASVSRLSTSSLPRIDEREPVCTLDDATITYADESF
DKTNEQEKTVTTAIFYKSDSLKSSNLLCSTSEKRLRFAMPASELTETDPLLENCDSLTNI
YPAKAQSKKDVAEKPSESIGIFSVNNRNDIVGEIATVANSAIATVSIDEDKLTHTKRMAK
QLKVKIGSKIGAALSKFENDHSQLKKGSDCAKIDTRSADVKSLRDRWEVSSATGTPLHPD
QEEDELLQAAIQMAKSLKQERMRPQSYCEPEGSVQISDFRPISAAYSTFCTQPTETMLQG
FAVNKEQEVVQEEINNAKISGKSNNEPNQLIDDAFQFIHRTPDRNSSLMSAILSTPEIRT
TLSSPTVASTGRDNVEAIAPLAHSVSFYRRKEKENRSGSETVMLGQFTASPLNSTAALNR
AVSKANMNDRANFEIERARLEKAISVQQEQIVQASRALSFCHTTQEFRGSREEVDAQRAL
LIATERRRALIFVLDRLIQKHATGGVQHSISDGPKGNLTFSDISVRLMRDFVNGHINYHD
DQLLFYFIALIRHEETVHHTTLTTSDEGICSGRLEFPHYIQFRSLPHDFSCTLEIFALRT
RRELLRHETKYHIKGGNSLKKSQKSMLSPGLVSLGGPSAVIDPSFQRVGHLSLNISSVNK
TRFHLSDTLYPLDGVVEMKVRCYAEDCGTVGYKGFLSLYQPIENIGSWARFWCVLWDGQL
RFWRYPEDESMKIPVVSIDLRTCACNEIKPIPVERCPYPNSMQIDVWLPGKCPQKPDRIR
ILMAADRKDEMYSWLNAMNISLRNLTLWSCRS
Download sequence
Identical sequences A0A1S0UBG8
LOAG_00324T0 XP_003135912.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]