SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_01295T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_01295T0
Domain Number 1 Region: 1100-1215
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000438
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_01295T0
Sequence length 1221
Comment | LOAG_01295 | Loa loa V3 hypothetical protein (1222 aa)
Sequence
MTLPGLHNKAYRASDNCLDAVDGEVSVNSLFASRCRSLSLSAQNCNRASIFTTTEDMNTA
IDIGKVASLSENDLLTSCTRLSSKCSHDNQTEILLTVLEHQKIPLGESHDCISLTDRSSN
LTLSPAHSNKSLNDSIPWGDVTPSVKPHIPTSKNSDVAKEDAPLPYMMLPDTDHTSGCDF
NRTQITSEEYVKGKTNVAQKTKELSKGELKKHSFVTQHTIIYPRSHLEMQCFPNSTCHFK
YEGESEDKQAVTLRKDQYSQTKEPVVTQSREDTNRAVSVLNIMLQRRLNNSGSQNGSFIQ
ERLNTYYSTPSAGLKSTQRISNFQSFTRTNELNDLIDKSDTPLRHSKYLSVEPEMDKKAI
VGANQQCVSVDQQLKENLNEYCRGNSYKKTTQKSVSDGRSTIRDHLPRGKTRKLASLFET
MSDAASVEMLREMDHLKRRGKSVPPNIVNKTYHRETEVNMKGLFRDDLILQQRSTLATNS
GSYGTHLDLTIPCKRNGFERLARDKCVVETRSVRSIVNRFESASDSSRCQNSARAFQTDT
PRKPKNQKRYSQYVTSTLQSVPGITSYSSIQDVQYAVDSNYNVCSIGRSLSRQSNEWNGS
SGRASPSHNLLYDSTSCANIWDQQQYELGLRKGITSLKRYDSRYNRGTNEMLSRDSSYAM
QTQVRQMNYSPEVKPSYHMDVVTDRSQKHTCGERLDNEVEDHVAEVEKAFAFVNKTQSLA
TPGQQCSQESLGKPSSPAKASYSISLYRDLEREHHKSRNGDIPVCFSPAIYSSPPSAGEL
LTTYEHKNSVMKNAKLGGQMVTTDPMATSTPLNGSPAGNSRLHTSASYALNRSGISSITA
STAHEIVQLQQSDIELQTVKQEIMIQEGQIAQASLALTHCKKNSSFNGTLVELSAQRSLL
LARERLLALRNEMQRLKTRRLVKEPVPPLAKRMRGAIDLTSINVYLNRNFCVRNIDEDVS
YAFVILLKTDEQVEATQTVTLMDTRALRVSKVHFSDQIRFTNLPVDFTVLLEIYALKVSE
NRRSDDYSCSMLKNKAKSLLSPSKKTCGNESVVDFSEFTCCGHICLNRDTIGMQKFYLDG
AVYPLEGTVEIDSRCTTLPPTIEIDFRGFLTMYQIIAGLGSWARYWAVLRCGVVQFWKYP
DDEASEKPALACMDLSKCTDKEISHAPHEICSRPNAFTVDLLVSTSPSLIEKKRVLLSAD
TKELCSAWLNALNGTLEVLRG
Download sequence
Identical sequences A0A1S0U9U5
XP_003136882.1.37734 LOAG_01295T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]