SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_04583T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_04583T0
Domain Number 1 Region: 338-457
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000738
Family Ran-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_04583T0
Sequence length 463
Comment | LOAG_04583 | Loa loa V3 hypothetical protein (464 aa)
Sequence
MKHTEAEKLFLDKMAVLNKTFLYFIQCSLKEMPDADLSPCVRDYLKHVEELDRTYGNFPG
QDDTNASTDNGKKDEAISDLPKISLSEKDVSDGSGTTVKSNMAQEKPASNAITVFSSTTN
PTNVSKLSFDVSTTSSSGSERRGRKRAKKGGPEGDDEEVIIPNHNTPTSPQLTSSEKYIK
TAPNQISHSSTLSPFFNSSSAENISKRDFDSNSDSKIETESGSFQEKSMNDIKETGTNKI
PLFSFGQKDDLKKNELLKNAQNFLFKSSSEKELVEKLDEKKEPNVESTCKSHVTPSFSFL
KPVLDEGNFGCSDSSKTKLDFKFGAPPAVQSEPNNESEESEYVPPKPEFVLAEEPKAIFS
SKCSVFVLKGTEYEKLGIGQLHIKTDETDSIKKILLIRAATTTGTVWVNSYIDESMKHVV
IEDVKLRISCVSGGSPSTYLLRLPKKENRDQVVAELQSDNISS
Download sequence
Identical sequences A0A1S0U3I0
LOAG_04583T0 XP_020303057.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]