SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_06319T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_06319T0
Domain Number 1 Region: 76-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-28
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 6-74
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-22
Family SH3-domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_06319T0
Sequence length 219
Comment | LOAG_06319 | Loa loa V3 variant SH3 domain-containing protein (220 aa)
Sequence
MTESKPPRPAPKPGRVTVYRALYDYTAQNDKELSFNEGDLLYVSDSSNDSQWWPARCRNQ
TGLIPANYVMTAEYIECPLHDAAKRGNIEGVKECLDNAVSVNGLDKSGSTPLYWSSHGGH
VAIVKLLCSIPNMCISAQNKIGDTALHAAAWKGHLECVRILLEHGASTIIHNNDRKLPVD
LASDPETRALIQLSMRQAIDTNDFRNEYSSESESETDGI
Download sequence
Identical sequences A0A1I7W5P2
LOAG_06319T0 XP_003141903.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]