SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_07087T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_07087T0
Domain Number 1 Region: 262-333
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-16
Family Phosphotyrosine-binding domain (PTB) 0.00028
Further Details:      
 
Weak hits

Sequence:  LOAG_07087T0
Domain Number - Region: 67-76,144-151
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000191
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 39-111,293-304
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.068
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_07087T0
Sequence length 343
Comment | LOAG_07087 | Loa loa V3 hypothetical protein (344 aa)
Sequence
MNIFSNFPFPPSQPSSSIIDSNHFITSENGQQHVEISTNRQTTNSMMTPVITDITISNGD
CLEQKIPPPPPPPPPPSSSSSSLSLSSVSKSVPSSSLPSATTITATTTTTPPTATTSTNI
QQKLLTQRRNDTKMNDERHRKNSLQTTSQNNWPGESDWMENEKQISNKESTIKNGHVEEN
SIEGEPIWVMRDSYLKRVQREENQSNEQAVEMNKNSERFEPAPDEVINETESLLSKDEQG
GDDGIKTKKGSKKEVIVHEPAVLIEGVLFRARYLGSTQLICEGRPTKASRMMQAQEAVAR
VKAPAGEIQPSTDIDLFISTEKIMVLNTDLQRISDTDVRQVLI
Download sequence
Identical sequences A0A1S0TWC9
XP_003142669.1.37734 LOAG_07087T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]