SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_17453T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_17453T0
Domain Number 1 Region: 243-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-77
Family Protein kinases, catalytic subunit 0.0000000373
Further Details:      
 
Domain Number 2 Region: 130-276
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-32
Family SH2 domain 0.0000837
Further Details:      
 
Domain Number 3 Region: 59-134
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-21
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_17453T0
Sequence length 528
Comment | LOAG_17453 | Loa loa V3 TK protein kinase (529 aa)
Sequence
MGNCFSGSRRQSSPSSGIRNERSSPKFLADRDSVEPLKEANCSEALTPRRHENRGLQDPT
PAKEVLVALYAYESRADGDLSFRKGDVMYLLDQSNSDWWYVRHSKGGTGYVPRNFVARQQ
TVENEFHRLTFGWFAGRIARNRAERLVLASNLPKGTFLIREREADTREYALTIRDSDDQR
GGTVKHYKIKRLDGDAGFFITTRRTFATLRDLVSYYSEVADGLCCQLSFPAPRIAPTRPD
LSHDTQQNWEIPRNQLQLKRKLGDGNFGDVWYGKWRGMVEVAIKTMKPGTMSPEAFLGEA
QIMKQCDHPNLVKLYAVCTKEEPFYIITEYMVNGALLHYLRSEGSSLTLQALVDMCAQVA
NGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPI
KWTAPEAATCGNFTVKSDVWSYGILLYEIITKGQVPYPGMHNREVIEQVELGYRMPMPRG
CPEQIYTEVMLKCWDKVPDRRPTFDYLFHFFDDYFVSSQPSYVPPSQN
Download sequence
Identical sequences A0A1I7VMG0
LOAG_17453T0 XP_020306260.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]