SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_18197T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_18197T0
Domain Number 1 Region: 1230-1412
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-38
Family DBL homology domain (DH-domain) 0.0000186
Further Details:      
 
Domain Number 2 Region: 1421-1535
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-24
Family Pleckstrin-homology domain (PH domain) 0.0000775
Further Details:      
 
Domain Number 3 Region: 250-399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000236
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 482-620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000995
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 801-954
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000667
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 11-163
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000262
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 7 Region: 1587-1658
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000578
Family SH3-domain 0.0029
Further Details:      
 
Domain Number 8 Region: 1050-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000042
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  LOAG_18197T0
Domain Number - Region: 690-807
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0129
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 626-722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0768
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_18197T0
Sequence length 1665
Comment | LOAG_18197 | Loa loa V3 RhoGEF domain-containing protein (1666 aa)
Sequence
MRDGCPKAEDILHVLRDRVALLPGTRDRNGRAVIIFPARENTTPINSDHIRNILIYLHAV
TADDYKDRGFTIIIDMRKGTTWNNVKPILKCIQEHFPAEVHTVLIIKPDKFWEKHKTSVS
SGKYKFDIQMISVEGLTRYVDSSQLTRDLGGSLLYDHDEWLETRLELERLIWQTIDVMHN
FENYREEMKNGEMPIDVATAERATAAHVVLKKKILGAPIERIQHDVEQVQQRISGFMGET
PDDSYNSSNGLLTTNPDLAAALPHLASLVNSLRTSKDEIFVQWETRRQKLDHCYQLKLFE
QDADKMFDWIRSHYTLSMQRLLEIGDSEQSTSMLLAEHLDFIAAANNTEVNVSHVMTVAK
RLREIGNYGKVQIENVAMHLDDEWRRFKQINEQRSRLLDLTLSFHHKSHIYLSNTPSWLH
SITLDNGRRMGQYSGDELEAAIAEHERFGEMFLQTYAEAVGDGRSLTQILKTLANDAVGQ
NNAYKHVVDLIQQITRAHKELYSQWQAKKLRLHSRLALIAFETDTHRVLQWLEEHGDAYL
NKNTAIGNNLSQAKMLQRNHSHFRSVASNTYSNAEKLFTASNTIIESGECDVQQMTVVVE
ELRRRIEAFSVRVEARRDLLNKSVLFHTHYSEIMEWYGRMEVKSSQYDIISTNVQEGERR
KEEWMIESDATAQAYATTMGEGNQLIRALEQQAKMMNIDNRETAAVIERLINDIEQRHAK
LADRWPHQRRSLQLGVKFAVFIKDCKQIIQQLKNWREDMVALVKSNNFAERAEHILPYQD
DNTTQVKNAVTGVKNNAAELLQALRDNESTLVNTEGILATDVIITSLQQLTDCQREVMQV
AQETHHRIEQCMQFNRARAMAAVAIQKMQYEETKLLHMNTIPTSLEEALAAQAAHKQFQH
AVESISRTTSAFLNKTDQLISSGGVDVRSVDDLNEEVLNRWRRLVGVTEERNKLIKAGVV
CYKTLHQGVMPILDQLEKEYSMSSKDWCQIRNGEDAKDRAHHMSSLLSKHMEYKERFLKG
CSYGQKTSEMFLKYIRRCEASAEHIRLHETRLLALKENLRKRQMKILDLWMRKKQQLDRC
HEACLLEATAAENNEWIAVEGEAFLKQCLERRLNLADRESLEAYMDEYMTFKAEAKQKRL
KVRMMLELAEKFLSTLDHHCNAIERKMFDVRSSYEHFSMRLADYENLLSGALGRKLDVNK
AKDEFSLDRKSDSNIEAKIEVEQLANEEKRKMREPMMELIKSEKDYIEDLHKCIKYYLSA
YRAVNDTLPIAIRDKEKEIFSNIEQLYKFHNEVFLPELTKHENDPEDVGYCFIFSVEMLN
TLYTEYCVNKEQNNYVIALPEAVQFFSEIREKSGLEHSQDLSSLVIKPVQRITRYRLMLE
QLLKNCKNNVDEIREAYDVVVSVPRRANDLMHLGNFENYKKLGVLGDFVMQESFLVWDPK
AYFKKGRERQVFLFELCVVFAKKTELSSRAIKYTYKTHLMLAEINVCEHVEGDASKFALR
QGNEPNTEMRTELKAASEQCKVHWVKKIRELMQGLMTANFDMRQIPARNSGATTTTSVSD
RTSKDSDSLPTSNEDRNSLRSCTSSSSNHNLEGHNEGCVAVDDFKASEKGQLSVTKGQRL
EVVEYCGDAPEWVLVSITWENGEQQRGLVPCSVISSIEPIGWFDF
Download sequence
Identical sequences A0A1S0UHX7
XP_020305414.1.37734 LOAG_18197T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]