SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOAG_18896T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_18896T0
Domain Number 1 Region: 267-417
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-30
Family Ribonuclease PH domain 1-like 0.0017
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-25
Family Ribonuclease PH domain 1-like 0.00037
Further Details:      
 
Domain Number 3 Region: 373-470
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-20
Family Ribonuclease PH domain 2-like 0.00021
Further Details:      
 
Domain Number 4 Region: 103-197
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-18
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 5 Region: 196-295
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000314
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 482-543
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 
Weak hits

Sequence:  LOAG_18896T0
Domain Number - Region: 827-859
Classification Level Classification E-value
Superfamily BRCT domain 0.019
Family 53BP1 0.043
Further Details:      
 
Domain Number - Region: 546-616
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0608
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_18896T0
Sequence length 985
Comment | LOAG_18896 | Loa loa V3 3' exoribonuclease family (986 aa)
Sequence
MVQVLATVVGRHSSTSDTADFMPLTVDFQQSASAVGRIPTNYLRRELQRNDADILASRMI
DRSIRPLFPKDYSGETQIICKPLAVDDDGDPVMLGLNAASAALTLSDIPWEGPLGAVRIA
LINNEIVVNPSRKNMKISSLDLVIAACDDGNRILMIDMDGCETGIEKFAACIETGLQAIS
YLIQAINKVRDSCGRQKRQNICGEIDIDMIALMEEMQILYGDQLYHILTDIEHDKLSRDR
AVSALGNHMLESLKERSTPHKLRHTFTNLLKKSLREALFKSERRCDGRKFDELRPVDIKM
DVHKKLHGSALFQRGQTQVFSTVTFDAPSAAFQPDALSQLLEDFPYCLRLACDVLESNGS
SSMASVCAGCLALLDAGVQMKTPAAGVAMGLIIDKERNDYRILTDINGLEDFAGDMDFKI
AGTVRGYTAMQLDLKVPGIKPEVMMESLEQARNGLEHLLQLMRKAQPFCRNHFKSTVPVH
ETIPVEIYKRHIIFRSGGYNAKLIESETGAKISVEDDANISIFAPNKVKLEEAKMMLTKM
FESESEIELVFGAMYKGEITDVLEHGVLVTLHKSMKPILLKNSNLDVRNVAHPKVLGFKV
GQKIIIQYLGRDPNTGPYQQVEQALFQSALLQDPTVTNPYWRAHTVLRSHDHFWNITLRE
ERICGPSSSSSISSKTVSSERQHPMRALCKLCMVQEEETTKESYPTGVPTVHILQRLSVA
LSSFTPPHEMVLERTSKGFSKSPVQEIDEYFELVAKLGRPLFKWEIIRCAFLWKLEQTMS
EMLCIEAESAVTEDDKKMLISDDNLRQQRQFILQKAAEFDGTPFTFQRLCELLISPSRHY
KRTDKYLRALEKNINVVTTITESGERVTGVEPFPGELDISSTLRIEEPFFVQVDECDAPV
ETKLIAAGDYFSRGNESPETIAKELVAGDCAPINLSPSRDAKDELPEIKQENNSEREAEH
GISQTESLTKPEMQNAKLEEMEVGD
Download sequence
Identical sequences A0A1S0UE29
LOAG_18896T0 XP_020304645.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]