SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390934194|ref|YP_006391699.1| from Thermoanaerobacterium saccharolyticum JW/SL-YS485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390934194|ref|YP_006391699.1|
Domain Number 1 Region: 50-150
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000942
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390934194|ref|YP_006391699.1|
Sequence length 278
Comment hypothetical protein Tsac_1087 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
Sequence
MLEIISCSRRTDIPAFYYDWLQECLKNKYVMVKNPYNKSTYMVDLSPERVHSICLWSKSF
ANVLKNPGFLSLYNLYFQFTITGYSKFLEPNVIDTNEAVRQMEQLALKYSPKQINWRFDP
IILSIKGENEPTPDNFERARLKVFEALCRDISSFGVNRCTISFLCLYKKVEQRMKESKFT
CSIPSQQQQIEFVSQLVEIADKYGVTIYTCTSHIIEGVPGVNKGHCIDGTYLEELFGKRA
SHAKDAGQRKGCGCTRSRDIGAYSGQSCGHGCLYCYAR
Download sequence
Identical sequences I3VUA5 W9EAJ9
gi|390934194|ref|YP_006391699.1| WP_014757984.1.3173 WP_014757984.1.7385 gi|390934194|ref|YP_006391699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]