SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390934447|ref|YP_006391952.1| from Thermoanaerobacterium saccharolyticum JW/SL-YS485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390934447|ref|YP_006391952.1|
Domain Number 1 Region: 38-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.49e-101
Family Amylase, catalytic domain 0.000000000000282
Further Details:      
 
Domain Number 2 Region: 607-709
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.7e-34
Family Starch-binding domain 0.00000107
Further Details:      
 
Domain Number 3 Region: 434-521
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.2e-31
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000528
Further Details:      
 
Domain Number 4 Region: 524-601
Classification Level Classification E-value
Superfamily E set domains 1.08e-16
Family E-set domains of sugar-utilizing enzymes 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390934447|ref|YP_006391952.1|
Sequence length 710
Comment alpha amylase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
Sequence
MKKTFKLILVLMLSLTLVFGLTAPIQAASDTAVSNVVNYSTDVIYQIVTDRFVDGNTSNN
PTGDLYDPTHTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYAVLPDSTFG
GSTSYHGYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPASETDPTYA
ENGRLYDNGTLLGGYTNDTNGYFHHYGGTDFSSYEDGIYRNLFDLADLNQQNSTIDSYLK
SAIKVWLDMGIDGIRLDAVKHMPFGWQKNFMDSILSYRPVFTFGEWFLGTNEIDANNTYF
ANESGMSLLDFRFSQKVRQVFRDNTDTMYGLDSMIQSTASDYNFINDMVTFIDNHDMDRF
YNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYMTGNGDPYNRAMMTSFNTSTTAYNVIKK
LAPLRKSNPAIAYGTTQQRWINNDVYIYERKFGNNVALVAINRNLSTSYNITGLYTALPA
GTYTDVLGGLLNGNSISVASDGSVTPFTLSAGEVAVWQYVSSSNSPLIGHVGPTMTKAGQ
TITIDGRGFGTTSGQVLFGSTAGTIVSWDDTEVKVKVPSVTPGKYNISLKTSSGATSNTY
NNINILTGNQICVRFVVNNASTVYGENVYLTGNVAELGNWDTSKAIGPMFNQVVYQYPTW
YYDVSVPAGTTIQFKFIKKNGNTITWEGGSNHTYTVPSSGTGTVIVNWQQ
Download sequence
Identical sequences I3VV08 W9E863
WP_014758229.1.3173 gi|390934447|ref|YP_006391952.1| gi|390934447|ref|YP_006391952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]