SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390935048|ref|YP_006392553.1| from Thermoanaerobacterium saccharolyticum JW/SL-YS485

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390935048|ref|YP_006392553.1|
Domain Number - Region: 53-127
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00812
Family Regulator of G-protein signaling, RGS 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390935048|ref|YP_006392553.1|
Sequence length 200
Comment hypothetical protein Tsac_1950 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
Sequence
MNDKGSALIFTLIIILILSVLALSILDISLFEYKTSYAYGNSITVDNAAEAGLDTAKGVF
NKSLFDNLNNLINNTANTLINEYNSLIPPQTVPKEVMYEAIYQAVRQYLENNVFNAYQNY
QFYLDDKNTISVTISYIKITDFQPFDGTNILPKYTIRIETIGNFKNLKRYGHAFIVLDLN
KSGNPISISSWVIDNTPPSS
Download sequence
Identical sequences D8X0D6 I3VWQ9 W9EB13
gi|390935048|ref|YP_006392553.1| WP_014758806.1.3173 gi|390935048|ref|YP_006392553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]