SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347535315|ref|YP_004842740.1| from Flavobacterium branchiophilum FL-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347535315|ref|YP_004842740.1|
Domain Number 1 Region: 46-256
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.12e-61
Family DNA/RNA non-specific endonuclease 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347535315|ref|YP_004842740.1|
Sequence length 264
Comment putative DNA/RNA non-specific endonuclease [Flavobacterium branchiophilum FL-15]
Sequence
MNLKRCLVVMSVLTIVFSCKEVHSDPTVGTDSQELRLSTDNNIDLLPTSTTGKIISHRYY
TLSYQEAHEQAEWVAYQLHGKVTNKHYNRPYFEEDPLVESGSASWKNYKNSGYDKGHLCA
AADMAFDFKAFEDTFYTSNISPQKHDFNDGIWNRLEQKVRYWSEKYGNIYVVTGGVLEEG
LEKIGREGVSVPKYFYKILLTKKNNQYQMIAFLVPHQSSNKALYEYVVSVDEIEAKTGID
FFSKLTNTLEEKLEQSSDYKNWSF
Download sequence
Identical sequences G2Z4M4
WP_014082983.1.101872 gi|347535315|ref|YP_004842740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]