SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347536261|ref|YP_004843686.1| from Flavobacterium branchiophilum FL-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347536261|ref|YP_004843686.1|
Domain Number 1 Region: 55-278
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.18e-38
Family Endonuclease I 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347536261|ref|YP_004843686.1|
Sequence length 373
Comment putative extracellular ribonuclease [Flavobacterium branchiophilum FL-15]
Sequence
MKKLYIKILICFTSFGMAQIPANYYNNATGTGYTLKTQLFNTINNNTNSASSSANYGGLW
TLYTENAFRDLYYENDNSLLDVYSEKPTGPDSYSYTGTSQQCGNYNSEGDCYNREHTVPQ
SYFGGSGSYPMYSDAHFVLPSDGKVNAQRNDFPYGKVNVATWTSTNGSKLGSNLNSGYSA
GYTSTVFEPIDEFKGDVARCLLYFVTRYQDQLSNFYSNSTSTAKVMFDGSSNHSFSNTFL
NILLTWHASDPVSNYEIAKNNAVYTFQGNRNPFIDHPEWVQSIWGSPLKISDFDSLENIV
VYPNPTNNKTIYINSDISLDEIELINLNGQLIQVIKNPLFINKSFDIQNLNQGFYFLKLK
AENQMIIKKIFVN
Download sequence
Identical sequences G2Z0P2
WP_014083916.1.101872 gi|347536261|ref|YP_004843686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]