SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365959255|ref|YP_004940822.1| from Flavobacterium columnare ATCC 49512

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365959255|ref|YP_004940822.1|
Domain Number 1 Region: 38-273
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.12e-40
Family Endonuclease I 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|365959255|ref|YP_004940822.1|
Sequence length 371
Comment extracellular ribonuclease [Flavobacterium columnare ATCC 49512]
Sequence
MKKNYLFFIFILSSFFGIGQNCPNDLKTYYSSATGVGYILKTQLYNIIKGHTVISYTPGL
WNLYYTSDVNSDGKVWDIYSNCNFVFGAPLLTGGNQDDGKGGKVECERYNREHTFPKSWF
GGSSGMPMYTDAFHVMPTDKKDNGMRGSIPYGIVGNNPTYVTNNNSKIGICTAPNTPTNL
TVFEPADQYKGDIARNYFYMATRYEDKISNWQNITVDANAVLDGSNDQVYEKWYLDLMIT
WHLQDPVSQKEIDRNNAVCAAQHNRNPFIDHPEYVCQIWSAQCQALSNAEFQLQTNISLY
PNPSNGELIKINSEIELDEIQVYNINGQLIQKDKNPIKKGESYDLVGLSRGFYLVKLTSG
TQSVTKKIIVQ
Download sequence
Identical sequences A0A290DSN7 G8X892
gi|365959255|ref|YP_004940822.1| WP_014164310.1.48360 WP_014164310.1.49381 WP_014164310.1.70420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]