SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365959256|ref|YP_004940823.1| from Flavobacterium columnare ATCC 49512

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365959256|ref|YP_004940823.1|
Domain Number 1 Region: 31-259
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.59e-43
Family Endonuclease I 0.0018
Further Details:      
 
Domain Number 2 Region: 276-454
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-23
Family Fibronectin type III 0.000062
Further Details:      
 
Domain Number 3 Region: 461-547
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-16
Family Fibronectin type III 0.0000599
Further Details:      
 
Weak hits

Sequence:  gi|365959256|ref|YP_004940823.1|
Domain Number - Region: 548-616
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0249
Family Lamin A/C globular tail domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|365959256|ref|YP_004940823.1|
Sequence length 795
Comment endonuclease I [Flavobacterium columnare ATCC 49512]
Sequence
MKSKTTFFALFCALVGHAQAPSGYYSSATGSGYTLKTQLYNIIKDHTDKGYAGLWTTYQT
SDRDKEYENDNSIIDVYSENPTGVDPYVYQYGTNQCGTYSGEGGCYNREHMIPQSVFNNA
APMVSDAHFIPPTDGKVNGMRSNYPHGMVAVPSWTSRNGGKLGSSAVSGYTGTVFEPINE
FKGDIARMYFYFATRYENTVANYSSYEMFNRTSNQVFAKPFLDMLLKWHAQDPVSAREIA
RNNAIYARQGNRNPFIDNPNYVNLIWGGSTADTIAPTVPSDLTSSGITTTACTLSWTAST
DNVGVTSYNVYLNDALKITVTGTNAIITGLTASTSYSFTVKAKDAAGNLSNASTILNVTT
ATGTDTVAPSNPTNLTASNITTTTCTLSWGASTDNVGVTGYDVYQGTILKTSVAGTTTTV
TGLTASTSYPFIVKAKDAAGNVSGSSNVLNVTTATGADTIAPSNPTNLTASNITTTTCTL
SWGASTDNIAVTGYDVYQGAIFKTSVTSTSATITGLTTSTSYSFTVKAKDAAGNVSGSSN
LLNVTTKANVTSVSDLYFSEYLEGSSNNKALEITNKTGVSVNLSSYVIKKQTNGSGSWST
GLKLAGTLADNQKFVIVNSLIASSCYSSTLANLSTTAGEMAYNGNDAIGLFKNGILIDII
GKFNGGTADFSIDETMRRKTTAVVPNTTFNKNTDWDIYGVDICSGLGNRIGKSTPNKKEV
NIKLYPNPTTGNFQIVFEDLSQRYTVEIYTTLGKKIREIAGITSGSISVNDLSKGIYLIK
INQNDNSVIKQVVVE
Download sequence
Identical sequences G8X893
WP_014164311.1.48360 WP_014164311.1.49381 WP_014164311.1.70420 gi|365959256|ref|YP_004940823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]