SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365959897|ref|YP_004941464.1| from Flavobacterium columnare ATCC 49512

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365959897|ref|YP_004941464.1|
Domain Number 1 Region: 48-254
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.77e-65
Family DNA/RNA non-specific endonuclease 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|365959897|ref|YP_004941464.1|
Sequence length 262
Comment DNA/RNA non-specific endonuclease [Flavobacterium columnare ATCC 49512]
Sequence
MNKMKGVFIVFIVLQLLVLSCKKEEELEEANFIHQEKKSDFLLPESKKGQVIDHNYYSLS
YREEHEQAEWVAYWLNRKDVVSIHRKRPYFINDPMIVSRSASWKNYIRSGYDRGHLCPAG
DRRFSKQAFEETFYTSNVTPQKKDFNAGIWNRLEQKVRYWAKKYNELYVVTGGVLSQKLN
HIGKENVTVPNYFYKIVLNKRGDTYHGIAFLLPHEDSDRPLYEFVVSIDKIEQLTEIDFF
PKLPDEIENRLERNQSYREWRF
Download sequence
Identical sequences A0A1V2YQW0 G8X6T6
gi|365959897|ref|YP_004941464.1| WP_014164952.1.48360 WP_014164952.1.49381 WP_014164952.1.70420 WP_014164952.1.85295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]