SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365961474|ref|YP_004943041.1| from Flavobacterium columnare ATCC 49512

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|365961474|ref|YP_004943041.1|
Domain Number - Region: 84-124
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00512
Family HNH-motif 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|365961474|ref|YP_004943041.1|
Sequence length 186
Comment hypothetical protein FCOL_12235 [Flavobacterium columnare ATCC 49512]
Sequence
MKYWIHIVIVSFSLGLFSANAQNKIKLIANDTITKQNTDPLRPAKAAFYSALLPGAGQAY
NKSYWKIPIVYAAIGTGVYAYFWNQKKYDSFRTEYIKRLAKDPDLNPEYNRLTDDKLIQG
QQFYQKNRDLSLLITIALYALNIIDANVDAHLQQFNVNNGLTIRPEIQTNDFNTQHNIGL
ALNFKF
Download sequence
Identical sequences A0A1V2YPN8 G8X9Q0
gi|365961474|ref|YP_004943041.1| WP_014166509.1.48360 WP_014166509.1.49381 WP_014166509.1.70420 WP_014166509.1.85295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]