SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365961485|ref|YP_004943052.1| from Flavobacterium columnare ATCC 49512

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365961485|ref|YP_004943052.1|
Domain Number 1 Region: 135-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.74e-34
Family Thioltransferase 0.0061
Further Details:      
 
Domain Number 2 Region: 23-126
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.49e-26
Family Single-domain sulfurtransferase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|365961485|ref|YP_004943052.1|
Sequence length 230
Comment thioredoxin family protein [Flavobacterium columnare ATCC 49512]
Sequence
MKNFLFSTFCATLIFFTSCKGQNNSITDHLEPKAFAEKITNADVYILDVRSPQEYTSQHL
DKAINIDYNAADFESKLSQLDKKKPVYLYCLSGGRSTKAMAKMSTMGFKEIHNMTGGIMK
WNAEGLSKPASTSGMTLVEFQKLVQSDKKVLIDFYAEWCGPCKKMAPYLEKMKEEMKGKI
TIIKIDADKNQQLAQDLQIEGLPTLIFYQEGKEVWKNLGFMKEEELKKKL
Download sequence
Identical sequences G8X9R1
gi|365961485|ref|YP_004943052.1| WP_014166520.1.70420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]