SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383449772|ref|YP_005356493.1| from Flavobacterium indicum GPTSA100-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383449772|ref|YP_005356493.1|
Domain Number 1 Region: 60-269
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.41e-56
Family DNA/RNA non-specific endonuclease 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383449772|ref|YP_005356493.1|
Sequence length 276
Comment DNA/RNA non-specific endonuclease precursor [Flavobacterium indicum GPTSA100-9]
Sequence
MKNKFTNYLYCFFLLFAIQSVFSCKEVVNDTSVSNSNIINNENQENYASSKNNLVFDYLP
SSTTNAVYKHKGYIFSYNEEYEQSEWVAYELEDGDWKYSEFERPLFNQDPLVITESAHWG
NYKKSGYTKGHLCPAGDRKQNQELFEETFYTSNVSPQTYEFNAGVWNRLEQKVRYWAGKY
DGLYVVTGGVLNDDLEVIGREHVAVPKYFYKVLMTKDQSKMIAFLVPHKNSKQPLYEFTT
SVDEIENITGINFFPKLEDAKENKMEANKSYKNWSF
Download sequence
Identical sequences H8XQE2
WP_014387580.1.21237 gi|383449772|ref|YP_005356493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]