SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383450765|ref|YP_005357486.1| from Flavobacterium indicum GPTSA100-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383450765|ref|YP_005357486.1|
Domain Number 1 Region: 31-274
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.71e-39
Family Endonuclease I 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|383450765|ref|YP_005357486.1|
Domain Number - Region: 311-363
Classification Level Classification E-value
Superfamily Fibronectin type III 0.042
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383450765|ref|YP_005357486.1|
Sequence length 372
Comment extracellular ribonuclease precursor [Flavobacterium indicum GPTSA100-9]
Sequence
MKKITLSIVLLLSGIAFAQIPSGYYNTATGTGYTLKTNLRKIIDNQNDGIPSEHISTDQG
YSGLYTTYLTSDKDFYYENDGSLLDMYTENPTGAECFFTYGTNQDDGTGGTAECQKYNRE
HIIPQSVFGSATPMYSDAHFVTPSDKYVNAQRGDLPFGVVSTATNTYSNGSKKGNNLNSG
YSAGYSSAVFEPIDEFKGDVARMILYFGTRYETQVASWSFPMFNGTSDQVFNNTFLNILL
KWHMIDPVSQREIDRNNAIYARQNNRNPYIDHPEYVCQIYPTQCSALAASSFALNEAIKI
FPNPTNTNEININTNEIIYNLELYTINGQLIKSVSNPVFTNNTYTLSNLTSGFYLFKVYS
DNGIAIKKILVN
Download sequence
Identical sequences H8XQY1
WP_014388554.1.21237 gi|383450765|ref|YP_005357486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]