SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383450851|ref|YP_005357572.1| from Flavobacterium indicum GPTSA100-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383450851|ref|YP_005357572.1|
Domain Number 1 Region: 337-563
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.77e-27
Family Endonuclease I 0.0031
Further Details:      
 
Domain Number 2 Region: 207-308
Classification Level Classification E-value
Superfamily CalX-like 0.000000222
Family CalX-beta domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383450851|ref|YP_005357572.1|
Sequence length 662
Comment ribonuclease [Flavobacterium indicum GPTSA100-9]
Sequence
MKIKLLILFFVSIFSNAQVVINEIDPDTPSTDVKEFIELHSISPNYSLNGLVLVMYNAGS
TPFTGVLSYYAIDLDGYTTDANGNFLIGNSQVSPTPALNLPETTLQNGPDVIALYTGNGS
DFPVGTSATSTNLMDAIAYSNAATTQPTALMTALNLTVCVNENATSNAANHSIQRKVDGT
YEVKAPTPGMNNDGSGIVFNYMTTTLNNTIYTEGQNVDITFTTSTNVTVDTAFSITLVNG
SFVTADYSGTTSIVIPAGTNTASTTLNLVDDSLDEGDEEFIVYISGLPTTVVASNNSVLR
RVEDNDFQISNFGTPLAPTFGNVLPTTPAGYYASLEGLSGATLKQAIQDIIANPSVVHLH
SYADIWDIIRIADQNPANHSKVWCMYIEQPMSKIDQQQGSSIIGKWNREHIFCQSRGGFE
VALGDTADGISIWNTTSAASVVDGVSDAHHIRVENGQENSSRNNKNYGNINSATVYAGPT
GTFGSWKGDVARSLFYMAVRFNGLNVVNGDPSEYNGANPSGNIGDLATLLAWNTQDPRDD
YEMNRNNYVYTWQNNRNPFIDYPQLVDYVFGIKYGEPWFSSLASSTFEFESVKVFPNPAS
EYLYVSGIENNTNVAIYTISGQKVYGSLVQNNDQISINFPAGVYFVNVTTSGKSITKKII
VK
Download sequence
Identical sequences H8XSX3
gi|383450851|ref|YP_005357572.1| WP_014388636.1.21237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]