SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383451707|ref|YP_005358428.1| from Flavobacterium indicum GPTSA100-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383451707|ref|YP_005358428.1|
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.12e-31
Family Endonuclease I 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383451707|ref|YP_005358428.1|
Sequence length 779
Comment bifunctional protein precursor : putative endonuclease 1 precursor and putative adhesin [Flavobacterium indicum GPTSA100-9]
Sequence
MKKILLFLLYSVVSFSQIPAYYSGIDFTQTGNNLKNQLATLITTTHTNQISYTPGVWNAL
QSGDLNPSNSSQVLLIYGFNDVDAIYKNDRTDLSTNICSSTCPTGSWNREHCYALSLGTP
ALVTSSPGPGTDAHHIRAADVTFNADRGNRLYTDGSGDAGPIGASNWYPGDEWKGDIARM
MMYMYVRYNTRCLATNVGSGPTTYSVDMPDIFLEWNEEDPVSPFEKTRNNVLQGIQGNRN
PFIDNPYLATLIWGGPQAPDSWNIIGCSTSTTWNGTAWTNGVPTKNVKAIFNGNYNSTGN
LDMCSMDVTGTAQVTLQTGHVFTIVRNISVASTANFTIQNNANLVQINNIANSGNINLIK
NSANLLRLDYTAWSSPVSNQNLLAFSPQTLTNRFYTYNPAGTTTATAYTSINPSSTNFNP
TTGYLIRSPNNWSATVSAPYIGQFTGVPNNGEFYTAIQQGYNLAGNPFPATIEGSHFIAS
NRTIETLYFWTHTAPASGGVYPVNNYASYTTLGGVAAAAGGAIPDGSIKPGQGFYFYSSE
NENVFFHNALRYNVMNTQFFKTNSVEKDIYRLNLSDSYQNYNQILIGHDANATEAFDLGI
DGKAFEYDDAMLFTTIDNNKYVIQGRPTFDSNDKLALGVKIKNDGLYTVQLENKEGVFNQ
QPIYLKDNFTGSITEISKQPYTFSSTAGLFTTRFELMYQLEKKSVKEHLITILNHDTEIV
MNSSSNMQLVTVYDLLGKKIYELNKTTNEAHLPIPKNNQIVLLEIQLEDGSIQHYKVIQ
Download sequence
Identical sequences H8XRD7
gi|383451707|ref|YP_005358428.1| WP_014389489.1.21237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]