SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392396847|ref|YP_006433448.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|392396847|ref|YP_006433448.1|
Domain Number - Region: 44-83
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family IMD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392396847|ref|YP_006433448.1|
Sequence length 324
Comment hypothetical protein Fleli_1218 [Flexibacter litoralis DSM 6794]
Sequence
MKKISYSLLFVFLFLLSFKSHSQNIGLGFLFRPNITLGTAIVPTQNVEDSLKFGMNRFYA
NLVVPLSGKLKLDLKNINASFTQHFLTINTGLRLPQGNLVEDNTKIYNFSAGITGIHANI
RSGIWFYTVNGGIVQDVQKLNESSPFFTAAGAYIRVKGIYKHNIYGVALLYQYERFLPVP
ILGINRRYNKKWFLELLLPAQGAMRYQFSKSFKAGLLVGLGSFRAGVNPSTNIVLPNLGG
KGNLNLDYTSIKITSVAELKIKNGVFLSSELGISTARSLSFLRTSDNEISFGASTVPYGA
INLHIDLQKSKTSPISSRLFGNDF
Download sequence
Identical sequences I4AI70
gi|392396847|ref|YP_006433448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]