SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392398437|ref|YP_006435038.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392398437|ref|YP_006435038.1|
Domain Number 1 Region: 326-604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-67
Family RecA protein-like (ATPase-domain) 0.0000000367
Further Details:      
 
Domain Number 2 Region: 286-360
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.71e-26
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 2-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000824
Family Rho termination factor, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392398437|ref|YP_006435038.1|
Sequence length 651
Comment transcription termination factor Rho [Flexibacter litoralis DSM 6794]
Sequence
MYNIEELNVRLLSELRIIATEMGLKNHSRLAKKDLIYKILDYQANKIEEDEDNDNNQEET
KKTSTSSKKETKKEPISTSSKILEKEEEKKDDSAKVSDKKESAYKLPTFSFLKKEKPESS
EVKEAKQDSTETKVATLTSNDTKEAKKEEPKKDDSIERIRETLRERKRANLIGKSDSGEN
KDSKESADSSQEAKEKTERRSRLDARNEERTENDNLRRRSRVNVKETDTKAPIQRASLRS
KAEEDSENETSQSEKTTRTNRNERSERKERPSNKKYNIREFDGVVTSEGVLEVISDGYGF
LRSSDYNYLASPDDVYISPSQIKLLGLKTGDTVKGQIRPPKDGEKYFALLRIESVNGKTT
EQIRDRVSFEHLTPLFPRERLNLSTKSNTYSTRMLDLFAPIGKGQRGMIVAQPKTGKTVL
LKEIANAIAENHPECYLLVLLIDERPEEVTDMERSVRGEVVASTFDEQADRHVKVANMVL
EKAKRLVECGHDVVILLDSITRLTRAYNTTVPSSGKILSGGVDANALHKPKRFFGAARNV
ENGGSLTIIATALIDTGSKMDEVIFEEFKGTGNMELQLDRKLANKRVYPAIDIPASGTRR
EDLLLDKETLQRVWILRRMMNDMHSNEAMDYMLKHMRGTKTNDEFLASMDN
Download sequence
Identical sequences I4AMR0
gi|392398437|ref|YP_006435038.1| WP_014798679.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]