SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392398935|ref|YP_006435536.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392398935|ref|YP_006435536.1|
Domain Number 1 Region: 995-1281
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.02e-44
Family Complement components 0.0017
Further Details:      
 
Domain Number 2 Region: 581-661
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000294
Family Carboxypeptidase regulatory domain 0.093
Further Details:      
 
Domain Number 3 Region: 1388-1471
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.0000209
Family Alpha-macroglobulin receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392398935|ref|YP_006435536.1|
Sequence length 1485
Comment hypothetical protein Fleli_3423 [Flexibacter litoralis DSM 6794]
Sequence
MQLNFFRMWHLLAGAALTAGAVTLWGFRSKNGDEWLKKLTEINTNFQEKYSSERVYLQLD
KSFYKPSETIWFQAYVQDEGTLKPSKRSDILHVEFIDPKGNVAKKIQLILEDGTAAGEFD
LTENAAGGLYKIKAYTQWQDNFIVEENTEDENGNSFIFEKEITVQKVVLPRLKMKLDFQK
DAYGAGDDVHADLDLQSLTNEPLTEKEIDFVVSLKGQVISKSKAKTDKKGKTTITFELPK
KLDTADGLLNVLISHNGQTESISRSIPLANTIFDLQFFPEGGDILANTNSNIAFWCKDEF
GKPADIQGIILDSKGKKVSTFSSFHKGMGNFEFEAKENETYTAKITQPKNVETTYKLPET
VEVGYGLKINYPVSKKNKEKNYETSNLDFSIYSPLMEEVFLVGKLRGQIIFSKKIAVKKG
STAINIPTDKMPIGVANFTLFDSKKIERAERLVFLNAEKQLNIDVKSNKEKYQPREKVTL
DIKVTDHRGIPMPANLSLSVVDDKLISFADDKSSTILSNLLLEADLKGEIKEPRFYFDKE
EDKAAQARDLLMLTHGWRAFTWEQVQKSSINLKYNAEKAIIAGTVNDENGKPAKNIKVEI
KGKDISTKTDKNGYFEFKNYKLYESITIKATDSSKTATQHITNYSQNYSLNLYDYNQIMK
RNMMRRGGAVPMMAAVPKDRKDKVVNDEIDFMEDEIADNIIFQNQMIVENTPIIEENEKE
AVKEIMEEVEIGFKDEELGGFAREENQFKKKIRAEKPNKPVIIYHRARVFPKVDYSKKEE
NNDTQEVSRTDFRSTIFWSGNIKIDAKGKSQVEFYASDEITAFRVICEGVASDGGIGRTE
SVFYTQLPFSLDTKLPLFMSMGDKISIPLQLHNNTKKELSGTVSADYPSSWIPISESKWK
NRITLQANETKVVNMDFLIENEAGKGKFIVQFIGQNGIQDRFEQEIEVFAKGFPAAVSLS
GENQDKTYSFEITSPVMGTSKATFTAFPSVLDDLLAGIESILREPYGCFEQTSSSTYPNL
LVMDYLSIQKDLNKEQQAALEKATALTEKGYKRLISFESKDKGYEWFGANPAHEALTAYG
LMEFKDMAAVTGNLVDEQMLTRTTNWLMERKDGKGGFKRNPQALDAFGGADDDITNAYII
YSLSEAGFKDIKTEAETAYQNAIKSKDPYLIGLVVNTLQNLNDKRSEKLLETLISLQEKE
GEESGAWKGTKHSITRSTGKGLTAETTSLALLALMKSDKKRMPILQNGVKYLVGSRSPYG
GFGNTQSTVLALKSLTAYAKYAQRTPESGDIEIYVNSKKVTTAHYEAGQQNAIEVENLGK
HLKAGKNTVRIHYVGVKEPLPYTFSAEWFTDLPKSSDKCSVKLETSLASSKVKIGETVRL
TTTLENTTKEGLPMTIAIVGLPGGLSAQPWQLKELIEKNKVDFYEIRNHSVVFYYRQMTP
NEKKTIYLDLKADLAGEYEGAASSAYLYYTSELKNWKKGLTVVSQ
Download sequence
Identical sequences I4AP58
gi|392398935|ref|YP_006435536.1| WP_014799169.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]