SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2034926670 from Dump bottom (Dump bottom)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2034926670
Domain Number - Region: 3-20
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0118
Family Type I dockerin domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2034926670
Sequence length 118
Comment ATEDB_5416700 hypothetical protein [Dump bottom (Dump bottom)]
Sequence
DLKYKDINGDGVINSDDVVPIGFPTVPEIIYGVGLSFGYEAFDLSVFFQGSARSSFFISP
NSITPFVNDGQRAVMQIIADDYWSVNNRDLYAFWPRLSDYPIANNNVASTHWLRNGSF
Download sequence
Identical sequences 2034926670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]