SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2010368751 from 5_050719P

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2010368751
Domain Number - Region: 104-149
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000615
Family Type I dockerin domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2010368751
Sequence length 156
Comment BISONP_685230 hypothetical protein [5_050719P]
Sequence
IGNPATATTGLEVAIPLSVLGNPQGEIKILAVLTGGADLNDQCRGTYLSNQSLPAMNIGD
TSQQFRNPAWARCPDPPFDSFPFSFVALAGEHYVSVQPCPAGPEGDVNGDGCVDDADLLI
VLFNFGNAGGQGDVNNDNIVDDADLLIVLFNFGAGC
Download sequence
Identical sequences 2010368751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]