SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2010298238 from 4_050719Q

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2010298238
Domain Number - Region: 198-243
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00051
Family Type I dockerin domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2010298238
Sequence length 250
Comment BISONQ_827420 hypothetical protein [4_050719Q]
Sequence
ASKATRQLYGPVGIKYELDDSNPNGWNVVKVQVFAWDVRDIVHKTSANKTRSFSDTAAPY
QIDIYVAQNDPNPASDPQTDPNWTLVGTLSKANGTLPNVCEWDPNTGNTFGECPQAMLNF
LNGANPAGVRFCDNPTHKVWYSTLNVSGQSGIKYVALVIPQGNQYNNDPDLRASNRVANS
LRYTNITDVRVIAQVGPEGDVNGDGCVDDADLLIVLFNFGNAGGQGDVNGDNIVDDADLL
IVLFNFGAGC
Download sequence
Identical sequences 2010298238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]