SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2004268721 from Guerrero Negro salt ponds hypersaline mat 02(H)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2004268721
Domain Number 1 Region: 102-156
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000275
Family Type I dockerin domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2004268721
Sequence length 162
Comment [Guerrero Negro salt ponds hypersaline mat 02(H)]
Sequence
FNGIGDIGDIELSLIRGYHTDPQEIPENVQNFKITVVPDQITSKFEAEKTVLLEIPFFVP
LLEEIRDGFHTFKIEVRNKNGEVGENVVIGLLPVFIGDPTLGDANFDNKITLVDAVHTLR
FIDGTEKLNELHLRVLDANKDEEISLEDYITLFQKFLFDFLQ
Download sequence
Identical sequences 2004268721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]