SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2014650667 from 6_Upper_euphotic

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2014650667
Domain Number - Region: 9-33
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00149
Family Type I dockerin domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2014650667
Sequence length 36
Comment delong_70m_86880 hypothetical protein [6_Upper_euphotic]
Sequence
MLRIPHFDGKFDLNGDGAVGLDDFFLFADNFGKEAA
Download sequence
Identical sequences 2014650667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]