SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2014258014 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2014258014
Domain Number 1 Region: 49-127
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000423
Family GHMP Kinase, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2014258014
Sequence length 285
Comment YNP1_75560 beta-ribofuranosylaminobenzene 5'-phosphate synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from Alice Springs, Crater Hills]
Sequence
MKLIGISRIHITLFDLEGKYGRLDGGMGVALKYPRIVIKTGECEEINIDGVPKEKFCIEE
DYPAHVGLGHTTQYLLSITKYAFEKNFQRKTSVELAKLVKRGSTSGIGVYAFEYGGFIVD
GGHSLKVKKEALPSDFSTAPPPPLLLRVDFPWYIYVNIPEGRRIFGKEELAAFKNAKLEG
LDTLARVVLMEFIPSVIEKDLENVLDALDRIQNLGFKKIEVSLQTDKVRELMKKLKSKGF
PSGISSFGPAVYTFVNSRREGEELVSTFGGFLTEPNNKGAKVVWN
Download sequence
Identical sequences F4B3W4
gi|332796949|ref|YP_004458449.1| 2014258014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]