SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2014262935 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2014262935
Domain Number 1 Region: 92-230
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.24e-22
Family FHA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  2014262935
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000916
Family Ran binding protein zinc finger-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2014262935
Sequence length 233
Comment YNP1_124790 FOG: FHA domain [Hot spring microbial community from Yellowstone Hot Springs, sample from Alice Springs, Crater Hills]
Sequence
MTWKCPICGYENSDDALFCMQCGAKKPENVKTEPPAVQQEANQQPPISAQPSAEPQAQQV
QAQEQSSQPVVVTEQSNQQLTSEGQSSVQTSVKQPIEQSVQQTSQTPSQSVSVGSATQQT
LQTPAGKYYLIFIATPVSALNKTKLPLEFDVFESISIGRSPENVIVIPDPEISRRHAIIS
LEGGKLYIEDLNSTNGTYLYDGKLFQPVKGKQELAPGSIIKLGSNTMLKIVIE
Download sequence
Identical sequences F4B8U0
WP_013775726.1.74519 2014262935 gi|332796608|ref|YP_004458108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]