SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2005168847 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005168847
Domain Number 1 Region: 96-230
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.23e-26
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.21e-18
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2005168847
Sequence length 257
Comment AFAHZA12934.g2_139_912 transcriptional regulator, GntR family [simHC - Simulated High Complexity Metagenome]
Sequence
MPSEVNKGAPAAETTARHIEDLILEGSLRPGDPLLPEREMALRLNVSRPTLRQGIRMLEE
RGLIVADPGGGRRVAPLATSITDPLIELMASRGEVVDDYLELRGTLEGMAASLAATRASD
VDRATLTRCMERIDLAHDEADFRDEAEADVDLHVAVYEASHNVVLLQIMRALSGMLRKGV
FHNREKLYARPEVRDVLRAQHRAIYDAIMVRDPEAAARAAQDHMTYTKRVRAEIIAAEAR
LEISLRRIEGGSLTARN
Download sequence
Identical sequences A1B669
gi|119385654|ref|YP_916709.1| 318586.Pden_2929 2005168847 WP_011749203.1.25907 WP_011749203.1.3707 WP_011749203.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]