SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2005169798 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005169798
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.42e-28
Family GntR ligand-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005169798
Sequence length 175
Comment AFAHZB14356.g2_154_681 transcriptional regulator, GntR family [simHC - Simulated High Complexity Metagenome]
Sequence
MRSLQTLGLTRSRSGSGSFVISDRQAPELAYGNYSARELIEARPFIEIPAAGWAALRRSE
EDMARLLQLCDSMERQEDALKWVRLDSDFHCLIAEAARNRLFARIVTDSRDSLMRQSELV
NLMADRRVTSNHEHRRIAEAIAAGSETEARTAMRDHLHEVEQAMTWIISQRPANS
Download sequence
Identical sequences A1B9W3
2005169798 gi|119386948|ref|YP_918003.1| 318586.Pden_4243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]