SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2005448186 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005448186
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.41e-63
Family Glutathione peroxidase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2005448186
Sequence length 158
Comment AFAWTX4882.y1_405_881 Glutathione peroxidase [simMC - Simulated Medium Complexity Metagenome]
Sequence
MTSVYDFSAKTLAGQQLPLQQFEGKVLLIVNTASACGFTPQYKGLEELQQAYGGRGFAVL
GFPCNQFGHQEPGDAAAIGQFCQKNYGVSFPMFDKVEVNGSDAHPLFRYLKAEKSGLLGA
AIKWNFTKFLVDRTGRVVARHAPTTTPQSLTKEIEALL
Download sequence
Identical sequences Q210I6
2005448186 2005450607 gi|90425149|ref|YP_533519.1| 316056.RPC_3665 WP_011474082.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]