SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2005471078 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005471078
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000398
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005471078
Sequence length 73
Comment AFPKV2892.x1_229_450 hypothetical protein [simMC - Simulated Medium Complexity Metagenome]
Sequence
MKIIEDENSGEVVIDNIRIEGFIYDEKCKKCNNFLVYYEKYDAFFCAYCNEWVESKCRDK
ECEFCKSRPEKPL
Download sequence
Identical sequences G2JC86
WP_020458076.1.31213 gi|346980504|ref|YP_004849448.1| 2005471078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]