SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_008612m|PACid:17969816 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_008612m|PACid:17969816
Domain Number 1 Region: 374-407
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000706
Family Rho termination factor, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_008612m|PACid:17969816
Sequence length 414
Sequence
MKKGAGVILVTDHSAKLPVFRFSYFVTREVVRLYFVTREVVRQCQGFGPSEGRCVPCSRI
PGKAVVASPCPSHGNHKIYSQVKIGSIKYASGAASFVCRASSGGPRRNPDFSKQNKRGFS
RNRNRQNEERDSFENLDESDMLTSKNGPLLALTNTSKFQATAAPGPSEKEIVELFRKVQA
QLRERAAVKEDKRVNTSKGKGKESETVDSLLKLLRKHTSAQGKKKEGSPEFAVDQQEQSG
SNSENKSTSFLNPNYKERSGGLEPDFSSFTRPPSNFRRKSPVPQVKFKPTHSNEDPVNSK
SYLNLNGEKKQQFEVIPDTAQQLELVQEEVELEFEPEPAFSFPDGDVLDELSGGEYSDIN
NIDADTDKQPEVEHEDLNSLKLTELRTIAKSRGVKGFSRMKKGELVELLTGSSI
Download sequence
Identical sequences cassava4.1_008612m|PACid:17969816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]