SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_009482m|PACid:17990542 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  cassava4.1_009482m|PACid:17990542
Domain Number - Region: 347-378
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00628
Family Rho termination factor, N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_009482m|PACid:17990542
Sequence length 386
Sequence
MKILCNSNIEVSGNEEHCSRATGKSKILSSSLNPEGKGNHPRKDKFAGTVVKNINAKELR
CATGIHVRKGNADSGLGTCSNTEIEQKLSDFSKEAAPKQTMKESKAAASQNVVSLNSPLK
TQGKKKSPPQIVKVVEAALTETENCALTSLLELQDKKGISAIKLLLKEGGKGMPEVNTSE
ICPDEENFHLDLSHSFHKEKAKMSIKLSTPIIQEIGFSTMVVDSSSSLVSEGKKHKKSGL
GPLTARLNQDHRTKKVVLQLAECKLKENGSSLGDGEKSVSQPQKKRKRSTNFPIIAEAKD
FTIQVDFSDSQIYTTNSNEDNQSVTDSCSIHDSSSVTLPSMPSASILEKMKLADLRDIAK
RCKLTKYYKLSKKELLQLLASKIGTC
Download sequence
Identical sequences cassava4.1_009482m|PACid:17990542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]