SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_009622m|PACid:17968373 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_009622m|PACid:17968373
Domain Number 1 Region: 342-375
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000745
Family Rho termination factor, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_009622m|PACid:17968373
Sequence length 382
Sequence
MSQAVHLIAKNLPGCGPSEGWYLPCSGISGKAVAVSHSFSHGSHRIHSHIKFGSIKCAAG
ASSFVCRASSGGPRRNSDFSKQSKQGFSRNRNRPNEERDSFENLDESDLLSSKNGPLLSF
SNTPKFQSTAAPGPREKEIVELFRKVQARLRERAAVKEEKKVETSKGKGKESETVDSLLK
LLRKHSIEQGKKKVSSQDFAVDQQEQRGSHSEGKSKVFLNRNNKERSGVLEPNSSSFTRP
PSNFRRKSPVPRGKFQPVYSNEDPANSTPYLNLNGEEKKKLEEIPDAVQQTELEAEEAEL
ELEQEPESSFPNGDVFNELSEEESSNIIDAEADSDIQEEIEHEDLSSLKLPELRAIAKSR
GVKGFSKMKKSELVELLSGGVV
Download sequence
Identical sequences A0A2C9UPN3
cassava4.1_009622m|PACid:17968373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]