SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_017957m|PACid:17975854 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_017957m|PACid:17975854
Domain Number 1 Region: 126-158
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000628
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_017957m|PACid:17975854
Sequence length 163
Sequence
MSPKQEEIISLFRRIQSSISKGENQRTKSTKPSNPNSSPTESILEILHQSKKPIKDGTGR
RGDKALTRKRGVKKDDKIQDDTQLPVANFNLTRPPSNFVKRSPIPSPSIPRGNAIETTDN
NKMLMLPKIEEMKLSELKELAKSRGLKGYSKLKKGELLELLRS
Download sequence
Identical sequences cassava4.1_017957m|PACid:17975854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]