SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_018992m|PACid:17979265 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_018992m|PACid:17979265
Domain Number 1 Region: 38-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.62e-30
Family Thioltransferase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_018992m|PACid:17979265
Sequence length 133
Sequence
MLKMPIKHHSREEASLFLLLLSLLLLKNAACASSSPSAFVQNVINSQRIVIFSKSYCPYC
MRAKHIFSELHEQPYVVELDLRDDGAQIQYVLLDLVGRRTVPQVFVNGKHIGGSDDLNAS
AESGQLQKLLATD
Download sequence
Identical sequences A0A2C9WNB9
cassava4.1_018992m|PACid:17979265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]