SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_022949m|PACid:17964206 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_022949m|PACid:17964206
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.84e-35
Family Glutathione peroxidase-like 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_022949m|PACid:17964206
Sequence length 162
Sequence
MAPVAVADTLPEGTLAHFDEQDQLQQVSVHSLAAGKKVVIVGVPGAFTPTCSLKHVPGFI
EKAEVLKSKGVGEILCISVNDPFVMKAWAKTYPENKHVKFLADGSASYTHALGLELDLKD
IGLGTRSRRFALLVDDLKVKAANLEEGGEFSISSVDEILKAL
Download sequence
Identical sequences A0A2C9W5B0
cassava4.1_022949m|PACid:17964206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]