SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_030398m|PACid:17987798 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_030398m|PACid:17987798
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.52e-29
Family Thioltransferase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_030398m|PACid:17987798
Sequence length 127
Sequence
MGENGHGQVMKSRVVKVGSEKSWDFFITQATSKGCPVVVHFTACWCMPSVAMNPFFEELA
VKYQDVLFLTVDVDEIKGVARKMEVKAMPTFMLIREGAEVDKLVGANPHEITKRINAFIH
SINSPKT
Download sequence
Identical sequences A0A2C9UDV4
cassava4.1_030398m|PACid:17987798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]