SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_030501m|PACid:17973809 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  cassava4.1_030501m|PACid:17973809
Domain Number - Region: 17-90
Classification Level Classification E-value
Superfamily TPR-like 0.000721
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_030501m|PACid:17973809
Sequence length 148
Sequence
MEKFHSLDPTVEHYGCMVDLLDRAGWLKRATDLIERMLGALLNACQIHGNTELGKQIGKF
LIELDPDHGGRHIHLANVHVAVGEWNEAAEGAIHGFLAGDGSHPQMKEIYCMRYSIAVQF
GIFNTNKISHELTTAVKSIAADAGRGVP
Download sequence
Identical sequences cassava4.1_030501m|PACid:17973809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]